- SF3B2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92380
- Rabbit
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- This antibody was developed against Recombinant Protein corresponding to amino acids: MSTVMSRKGP APELQGVEVA LAPEELELDP MAMTQKYEEH VREQQAQVEK EDFSDMVAEH AAKQKQKKRK AQPQDSRGGS KKYKEFK
- Human
- 0.1 ml
- SF3B2
- CFM, Cus1, HFM, SAP145, SF3B145, SF3b1, SF3b150
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- splicing factor 3b subunit 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFK
Specifications/Features
Available conjugates: Unconjugated